NCOR2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574216
Artikelname: NCOR2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574216
Hersteller Artikelnummer: orb574216
Alternativnummer: BYT-ORB574216-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR2
Konjugation: Unconjugated
Alternative Synonym: SMRT, TRAC, CTG26, SMRTE, TRAC1, N-CoR2, TNRC14, TRAC-1, SMAP270, SMRTE-tau
Rabbit polyclonal antibody to NCOR2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 275kDa
NCBI: 006303
UniProt: Q9Y618
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE
Target-Kategorie: NCOR2
WB Suggested Anti-NCOR2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, NCOR2 is supported by BioGPS gene expression data to be expressed in HeLa.