NCOR2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574216
Article Name: NCOR2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574216
Supplier Catalog Number: orb574216
Alternative Catalog Number: BYT-ORB574216-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR2
Conjugation: Unconjugated
Alternative Names: SMRT, TRAC, CTG26, SMRTE, TRAC1, N-CoR2, TNRC14, TRAC-1, SMAP270, SMRTE-tau
Rabbit polyclonal antibody to NCOR2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 275kDa
NCBI: 006303
UniProt: Q9Y618
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE
Target: NCOR2
WB Suggested Anti-NCOR2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, NCOR2 is supported by BioGPS gene expression data to be expressed in HeLa.