NCOR2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: NCOR2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574216
• Supplier Catalog Number: orb574216
• Alternative Catalog Number: BYT-ORB574216-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR2
• Conjugation: Unconjugated
• Alternative Names: SMRT, TRAC, CTG26, SMRTE, TRAC1, N-CoR2, TNRC14, TRAC-1, SMAP270, SMRTE-tau

Product Description

Rabbit polyclonal antibody to NCOR2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 275kDa
• NCBI: 006303
• UniProt: Q9Y618
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE
• Target: NCOR2

Images

WB Suggested Anti-NCOR2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, NCOR2 is supported by BioGPS gene expression data to be expressed in HeLa.