COLEC12 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574231
Artikelname: COLEC12 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574231
Hersteller Artikelnummer: orb574231
Alternativnummer: BYT-ORB574231-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COLEC12
Konjugation: Unconjugated
Alternative Synonym: CLP1, NSR2, SRCL, SCARA4
Rabbit polyclonal antibody to COLEC12
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 82kDa
NCBI: 569057
UniProt: Q5KU26
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDC
Target-Kategorie: COLEC12
WB Suggested Anti-COLEC12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.