COLEC12 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574231
Article Name: COLEC12 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574231
Supplier Catalog Number: orb574231
Alternative Catalog Number: BYT-ORB574231-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COLEC12
Conjugation: Unconjugated
Alternative Names: CLP1, NSR2, SRCL, SCARA4
Rabbit polyclonal antibody to COLEC12
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 82kDa
NCBI: 569057
UniProt: Q5KU26
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDC
Target: COLEC12
WB Suggested Anti-COLEC12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.