ZKSCAN5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574250
| Artikelname: |
ZKSCAN5 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574250 |
| Hersteller Artikelnummer: |
orb574250 |
| Alternativnummer: |
BYT-ORB574250-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN5 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ZFP95, ZFP-95, ZNF914, ZSCAN37 |
| Rabbit polyclonal antibody to ZKSCAN5 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
97kDa |
| NCBI: |
055384 |
| UniProt: |
Q9Y2L8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN |
| Target-Kategorie: |
ZKSCAN5 |
![]()
|
WB Suggested Anti-ZKSCAN5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach. |
