ZKSCAN5 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574250
Article Name: ZKSCAN5 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574250
Supplier Catalog Number: orb574250
Alternative Catalog Number: BYT-ORB574250-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN5
Conjugation: Unconjugated
Alternative Names: ZFP95, ZFP-95, ZNF914, ZSCAN37
Rabbit polyclonal antibody to ZKSCAN5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 97kDa
NCBI: 055384
UniProt: Q9Y2L8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN
Target: ZKSCAN5
WB Suggested Anti-ZKSCAN5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach.