NR5A1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: NR5A1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574253
• Hersteller Artikelnummer: orb574253
• Alternativnummer: BYT-ORB574253-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR5A1
• Konjugation: Unconjugated
• Alternative Synonym: ELP, SF1, FTZ1, POF7, SF-1, AD4BP, FTZF1, SPGF8, SRXX4, SRXY3, hSF-1

Produktbeschreibung

Rabbit polyclonal antibody to NR5A1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 52kDa
• NCBI: 004950
• UniProt: Q13285
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV
• Target-Kategorie: NR5A1

Bilder

WB Suggested Anti-NR5A1 Antibody Titration: 20 ug/ml, Positive Control: Daudi cell lysate, NR5A1 is supported by BioGPS gene expression data to be expressed in Daudi.