NR5A1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: NR5A1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574253
• Supplier Catalog Number: orb574253
• Alternative Catalog Number: BYT-ORB574253-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NR5A1
• Conjugation: Unconjugated
• Alternative Names: ELP, SF1, FTZ1, POF7, SF-1, AD4BP, FTZF1, SPGF8, SRXX4, SRXY3, hSF-1

Product Description

Rabbit polyclonal antibody to NR5A1

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 52kDa
• NCBI: 004950
• UniProt: Q13285
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV
• Target: NR5A1

Images

WB Suggested Anti-NR5A1 Antibody Titration: 20 ug/ml, Positive Control: Daudi cell lysate, NR5A1 is supported by BioGPS gene expression data to be expressed in Daudi.