ZNF776 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574254
Artikelname: ZNF776 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574254
Hersteller Artikelnummer: orb574254
Alternativnummer: BYT-ORB574254-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776
Konjugation: Unconjugated
Alternative Synonym: ZNF776,
Rabbit polyclonal antibody to ZNF776
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 56kDa
NCBI: 775903
UniProt: Q68DI1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG
Target-Kategorie: ZNF776
Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.