ZNF776 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574254
Article Name: ZNF776 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574254
Supplier Catalog Number: orb574254
Alternative Catalog Number: BYT-ORB574254-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF776
Conjugation: Unconjugated
Alternative Names: ZNF776,
Rabbit polyclonal antibody to ZNF776
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 56kDa
NCBI: 775903
UniProt: Q68DI1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTG
Target: ZNF776
Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.