HCLS1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HCLS1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574291
• Hersteller Artikelnummer: orb574291
• Alternativnummer: BYT-ORB574291-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
• Konjugation: Unconjugated
• Alternative Synonym: HS1, p75, CTTNL, lckBP1

Produktbeschreibung

Rabbit polyclonal antibody to HCLS1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 54kDa
• NCBI: 005326
• UniProt: P14317
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV
• Target-Kategorie: HCLS1

Bilder

WB Suggested Anti-HCLS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.