HCLS1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: HCLS1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574291
• Supplier Catalog Number: orb574291
• Alternative Catalog Number: BYT-ORB574291-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
• Conjugation: Unconjugated
• Alternative Names: HS1, p75, CTTNL, lckBP1

Product Description

Rabbit polyclonal antibody to HCLS1

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 54kDa
• NCBI: 005326
• UniProt: P14317
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV
• Target: HCLS1

Images

WB Suggested Anti-HCLS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.