HOXA7 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HOXA7 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574306
• Hersteller Artikelnummer: orb574306
• Alternativnummer: BYT-ORB574306-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA7
• Konjugation: Unconjugated
• Alternative Synonym: ANTP, HOX1, HOX1A, HOX1.1

Produktbeschreibung

Rabbit polyclonal antibody to HOXA7

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 25kDa
• NCBI: 008827
• UniProt: P31268
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
• Target-Kategorie: HOXA7

Bilder

WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat.