HOXA7 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: HOXA7 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574306
• Supplier Catalog Number: orb574306
• Alternative Catalog Number: BYT-ORB574306-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA7
• Conjugation: Unconjugated
• Alternative Names: ANTP, HOX1, HOX1A, HOX1.1

Product Description

Rabbit polyclonal antibody to HOXA7

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 25kDa
• NCBI: 008827
• UniProt: P31268
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
• Target: HOXA7

Images

WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat.