HOXC10 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574308
Artikelname: HOXC10 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574308
Hersteller Artikelnummer: orb574308
Alternativnummer: BYT-ORB574308-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC10
Konjugation: Unconjugated
Alternative Synonym: HOX3I
Rabbit polyclonal antibody to HOXC10
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 38kDa
NCBI: 059105
UniProt: Q9NYD6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAA
Target-Kategorie: HOXC10
WB Suggested Anti-HOXC10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.