HOXC10 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574308
Article Name: HOXC10 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574308
Supplier Catalog Number: orb574308
Alternative Catalog Number: BYT-ORB574308-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC10
Conjugation: Unconjugated
Alternative Names: HOX3I
Rabbit polyclonal antibody to HOXC10
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 38kDa
NCBI: 059105
UniProt: Q9NYD6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAA
Target: HOXC10
WB Suggested Anti-HOXC10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.