SUPT5H Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SUPT5H Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574637
• Hersteller Artikelnummer: orb574637
• Alternativnummer: BYT-ORB574637-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUPT5H
• Konjugation: Unconjugated
• Alternative Synonym: SPT5, SPT5H, Tat-CT1

Produktbeschreibung

Rabbit polyclonal antibody to SUPT5H

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 121kDa
• NCBI: 003160
• UniProt: O00267
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA
• Target-Kategorie: SUPT5H

Bilder

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained in an isoform present at ~105 kDa. The protein is heavily modified by phosphorylation.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

Human kidney

Human Pancreas

Rabbit Anti-SUPT5H Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SUPT5H Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.