Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA
Target:
SUPT5H
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained in an isoform present at ~105 kDa. The protein is heavily modified by phosphorylation.
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.