TBX5 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TBX5 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574649
• Hersteller Artikelnummer: orb574649
• Alternativnummer: BYT-ORB574649-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5
• Konjugation: Unconjugated
• Alternative Synonym: HOS

Produktbeschreibung

Rabbit polyclonal antibody to TBX5

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 58 kDa
• NCBI: 000183
• UniProt: Q99593
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
• Target-Kategorie: TBX5

Bilder

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Several isoforms in the region of 58-60 kDa contain this peptide sequence.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 2 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.

Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0 ug/ml using anti-TBX5 antibody (orb574649).