TBX5 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TBX5 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574649
• Supplier Catalog Number: orb574649
• Alternative Catalog Number: BYT-ORB574649-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5
• Conjugation: Unconjugated
• Alternative Names: HOS

Product Description

Rabbit polyclonal antibody to TBX5

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 58 kDa
• NCBI: 000183
• UniProt: Q99593
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT
• Target: TBX5

Images

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Several isoforms in the region of 58-60 kDa contain this peptide sequence.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 2 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 3 ug/ml.

Immunohistochemistry with Human Brain, cortex tissue at an antibody concentration of 5.0 ug/ml using anti-TBX5 antibody (orb574649).