A1BG Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: A1BG Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574833
• Hersteller Artikelnummer: orb574833
• Alternativnummer: BYT-ORB574833-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Konjugation: Unconjugated
• Alternative Synonym: A1B, ABG, GAB, HYST2477

Produktbeschreibung

Rabbit polyclonal antibody to A1BG

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 54kDa
• NCBI: 570602
• UniProt: P04217
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
• Target-Kategorie: A1BG

Bilder

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. A1BG s supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-A1BG Antibody, Titration: 0.1 ug/ml, Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.