A1BG Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: A1BG Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB574833
• Supplier Catalog Number: orb574833
• Alternative Catalog Number: BYT-ORB574833-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human A1BG
• Conjugation: Unconjugated
• Alternative Names: A1B, ABG, GAB, HYST2477

Product Description

Rabbit polyclonal antibody to A1BG

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 54kDa
• NCBI: 570602
• UniProt: P04217
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
• Target: A1BG

Images

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. A1BG s supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-A1BG Antibody, Titration: 0.1 ug/ml, Positive Control: Fetal Liver.

WB Suggested Anti-A1BG Antibody, Titration: 5 ug/ml, Positive Control: human liver, human serum, human plasma.

WB Suggested Anti-A1BG Antibody, Titration: 1.25 ug/ml, Positive Control: HepG2 Whole Cell. A1BG is supported by BioGPS gene expression data to be expressed in HepG2.