TRPM4 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TRPM4 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB575427
• Hersteller Artikelnummer: orb575427
• Alternativnummer: BYT-ORB575427-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
• Konjugation: Unconjugated
• Alternative Synonym: EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4

Produktbeschreibung

Rabbit polyclonal antibody to TRPM4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 134 kDa
• NCBI: 060106
• UniProt: Q8TD43
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
• Target-Kategorie: TRPM4

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.