TRPM4 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TRPM4 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB575427
• Supplier Catalog Number: orb575427
• Alternative Catalog Number: BYT-ORB575427-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM4
• Conjugation: Unconjugated
• Alternative Names: EKVP6, LTrpC4, PFHB1B, TRPM4B, hTRPM4

Product Description

Rabbit polyclonal antibody to TRPM4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 134 kDa
• NCBI: 060106
• UniProt: Q8TD43
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
• Target: TRPM4

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-TRPM4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.