RPS14 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: RPS14 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB577534
• Hersteller Artikelnummer: orb577534
• Alternativnummer: BYT-ORB577534-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS14
• Konjugation: Unconjugated
• Alternative Synonym: S14, EMTB

Produktbeschreibung

Rabbit polyclonal antibody to RPS14

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 17kDa
• NCBI: 001020242
• UniProt: P62263
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
• Target-Kategorie: RPS14

Bilder

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-RPS14 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.