RPS14 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RPS14 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB577534
• Supplier Catalog Number: orb577534
• Alternative Catalog Number: BYT-ORB577534-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS14
• Conjugation: Unconjugated
• Alternative Names: S14, EMTB

Product Description

Rabbit polyclonal antibody to RPS14

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 17kDa
• NCBI: 001020242
• UniProt: P62263
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
• Target: RPS14

Images

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-RPS14 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.