RBM47 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: RBM47 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB577838
• Hersteller Artikelnummer: orb577838
• Alternativnummer: BYT-ORB577838-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM47
• Konjugation: Unconjugated
• Alternative Synonym: NET18

Produktbeschreibung

Rabbit polyclonal antibody to RBM47

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 64 kDa
• NCBI: 061900
• UniProt: A0AV96
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
• Target-Kategorie: RBM47

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. PrimaryAntibody concentration 5 ug/ml.

WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226.