Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
Target:
RBM47
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.
Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. PrimaryAntibody concentration 5 ug/ml.