WNT7B Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: WNT7B Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB577994
• Hersteller Artikelnummer: orb577994
• Alternativnummer: BYT-ORB577994-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT7B
• Konjugation: Unconjugated

Produktbeschreibung

Rabbit polyclonal antibody to WNT7B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 39 kDa
• NCBI: 478679
• UniProt: P56706
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
• Target-Kategorie: WNT7B

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.