WNT7B Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: WNT7B Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB577994
• Supplier Catalog Number: orb577994
• Alternative Catalog Number: BYT-ORB577994-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT7B
• Conjugation: Unconjugated

Product Description

Rabbit polyclonal antibody to WNT7B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 39 kDa
• NCBI: 478679
• UniProt: P56706
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
• Target: WNT7B

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.