POSTN Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB578117
Artikelname: POSTN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB578117
Hersteller Artikelnummer: orb578117
Alternativnummer: BYT-ORB578117-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POSTN
Konjugation: Unconjugated
Alternative Synonym: PN, OSF2, OSF-2, PDLPOSTN
Rabbit polyclonal antibody to POSTN
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 93kDa
NCBI: 006466
UniProt: Q15063
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ
Target-Kategorie: POSTN
Anti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-POSTN Antibody, Paraffin Embedded Tissue: Human Uterus, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-POSTN Antibody, Titration: 1 ug/ml, Positive Control: 293T cells lysate.