POSTN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578117
| Artikelname: |
POSTN Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB578117 |
| Hersteller Artikelnummer: |
orb578117 |
| Alternativnummer: |
BYT-ORB578117-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human POSTN |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PN, OSF2, OSF-2, PDLPOSTN |
| Rabbit polyclonal antibody to POSTN |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
93kDa |
| NCBI: |
006466 |
| UniProt: |
Q15063 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ |
| Target-Kategorie: |
POSTN |
|
Anti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
Anti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml. |
|
Rabbit Anti-POSTN Antibody, Paraffin Embedded Tissue: Human Uterus, Antibody Concentration: 5 ug/ml. |
|
WB Suggested Anti-POSTN Antibody, Titration: 1 ug/ml, Positive Control: 293T cells lysate. |