POSTN Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: POSTN Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578117
• Supplier Catalog Number: orb578117
• Alternative Catalog Number: BYT-ORB578117-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POSTN
• Conjugation: Unconjugated
• Alternative Names: PN, OSF2, OSF-2, PDLPOSTN

Product Description

Rabbit polyclonal antibody to POSTN

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 93kDa
• NCBI: 006466
• UniProt: Q15063
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ
• Target: POSTN

Images

Anti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-POSTN Antibody, Paraffin Embedded Tissue: Human Uterus, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-POSTN Antibody, Titration: 1 ug/ml, Positive Control: 293T cells lysate.