FAH Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: FAH Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578162
• Hersteller Artikelnummer: orb578162
• Alternativnummer: BYT-ORB578162-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
• Konjugation: Unconjugated

Produktbeschreibung

Rabbit polyclonal antibody to FAH

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 46kDa
• NCBI: 000128
• UniProt: P16930
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
• Target-Kategorie: FAH

Bilder

FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with human liver, mouse KO tissue.

Immunohistochemistry with human liver, mouse KO tissue.

Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.