FAH Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB578162
- Images (6)
| Article Name: | FAH Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB578162 |
| Supplier Catalog Number: | orb578162 |
| Alternative Catalog Number: | BYT-ORB578162-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human FAH |
| Conjugation: | Unconjugated |
| Rabbit polyclonal antibody to FAH |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 46kDa |
| NCBI: | 000128 |
| UniProt: | P16930 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
| Target: | FAH |
|
|
FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml. |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml. |
|
|
Immunohistochemistry with human liver, mouse KO tissue. |
|
|
Immunohistochemistry with human liver, mouse KO tissue. |
|
|
Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400. |
Product Guarantee and Expert Support
