OTC Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB578205
Artikelname: OTC Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB578205
Hersteller Artikelnummer: orb578205
Alternativnummer: BYT-ORB578205-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTC
Konjugation: Unconjugated
Alternative Synonym: OCTD, OTCD
Rabbit polyclonal antibody to OTC
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 40 kDa
NCBI: 000522
UniProt: P00480
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
Target-Kategorie: OTC
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Positive control (+): 293T (2T), Negative control (-): Human lung (LU), Antibody concentration: 0.42 ug/ml.
Rabbit Anti-OTC Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-OTC Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.