OTC Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: OTC Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB578205
• Supplier Catalog Number: orb578205
• Alternative Catalog Number: BYT-ORB578205-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTC
• Conjugation: Unconjugated
• Alternative Names: OCTD, OTCD

Product Description

Rabbit polyclonal antibody to OTC

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 40 kDa
• NCBI: 000522
• UniProt: P00480
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
• Target: OTC

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): 293T (2T), Negative control (-): Human lung (LU), Antibody concentration: 0.42 ug/ml.

Rabbit Anti-OTC Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-OTC Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.