KRT8 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578310
| Artikelname: |
KRT8 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB578310 |
| Hersteller Artikelnummer: |
orb578310 |
| Alternativnummer: |
BYT-ORB578310-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
K8, KO, CK8, CK-8, CYK8, K2C8, CARD2 |
| Rabbit polyclonal antibody to KRT8 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
53kDa |
| NCBI: |
002264 |
| UniProt: |
P05787 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL |
| Target-Kategorie: |
KRT8 |
![]()
|
KRT8 Antibody (orb578310), Catalog Number: orb578310, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
![]()
|
Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
![]()
|
Sample Type: Human Triple Negative Breast Cancer Xenografts, Primary Dilution: 1:100, Secondary (Anti-Rabbit 594) Dilution: 1:200. |
![]()
|
Small intestine |
![]()
|
WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. |
