KRT8 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB578310
| Article Name: |
KRT8 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB578310 |
| Supplier Catalog Number: |
orb578310 |
| Alternative Catalog Number: |
BYT-ORB578310-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
K8, KO, CK8, CK-8, CYK8, K2C8, CARD2 |
| Rabbit polyclonal antibody to KRT8 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
53kDa |
| NCBI: |
002264 |
| UniProt: |
P05787 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL |
| Target: |
KRT8 |
![]()
|
KRT8 Antibody (orb578310), Catalog Number: orb578310, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
![]()
|
Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
![]()
|
Sample Type: Human Triple Negative Breast Cancer Xenografts, Primary Dilution: 1:100, Secondary (Anti-Rabbit 594) Dilution: 1:200. |
![]()
|
Small intestine |
![]()
|
WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. |
