MMP1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: MMP1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578315
• Hersteller Artikelnummer: orb578315
• Alternativnummer: BYT-ORB578315-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Equine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
• Konjugation: Unconjugated
• Alternative Synonym: CLG, CLGN

Produktbeschreibung

Rabbit polyclonal antibody to MMP1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 54kDa
• NCBI: 002412
• UniProt: P03956
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
• Target-Kategorie: MMP1

Bilder

Sample Type: Equine Cartilage Explants, Primary Dilution: 1:800.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Human Colorectal cancer sample, Human Liver Sample.

MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Antibody Titration: 2-10 ug/ml, Positive Control: Human epithelial cells ovarian carcinoma.

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

species sample: Human, cell/tissue: macrophagesHuman macrophages, Dilution: 1/200.

WB Suggested Anti-MMP1 Antibody, Positive Control: Lane 1: 15 ug HT29 cell lysate. Lane 2: 15 ug HT29 cell lysate. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.

WB Suggested Anti-MMP1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.