MMP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB578315
Article Name: MMP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB578315
Supplier Catalog Number: orb578315
Alternative Catalog Number: BYT-ORB578315-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Equine, Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
Conjugation: Unconjugated
Alternative Names: CLG, CLGN
Rabbit polyclonal antibody to MMP1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 54kDa
NCBI: 002412
UniProt: P03956
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Target: MMP1
Sample Type: Equine Cartilage Explants, Primary Dilution: 1:800.
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Human Colorectal cancer sample, Human Liver Sample.
MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Antibody Titration: 2-10 ug/ml, Positive Control: Human epithelial cells ovarian carcinoma.
Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
species sample: Human, cell/tissue: macrophagesHuman macrophages, Dilution: 1/200.
WB Suggested Anti-MMP1 Antibody, Positive Control: Lane 1: 15 ug HT29 cell lysate. Lane 2: 15 ug HT29 cell lysate. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.
WB Suggested Anti-MMP1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.