IDH3A Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: IDH3A Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578394
• Hersteller Artikelnummer: orb578394
• Alternativnummer: BYT-ORB578394-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IDH3A
• Konjugation: Unconjugated
• Alternative Synonym: RP90

Produktbeschreibung

Rabbit polyclonal antibody to IDH3A

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 40kDa
• NCBI: 005521
• UniProt: P50213
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK
• Target-Kategorie: IDH3A

Bilder

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): 293T (2T), Negative control (-): Liver tumor (T-LI), Antibody concentration: 1 ug/ml.

IDH3A was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb578394 with 1:200 dilution. Western blot was performed using orb578394 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: IDH3A IP with orb578394 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Rabbit Anti-IDH3A Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-IDH3A Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate. IDH3A is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.