SLCO2B1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SLCO2B1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB578985
• Hersteller Artikelnummer: orb578985
• Alternativnummer: BYT-ORB578985-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
• Konjugation: Unconjugated
• Alternative Synonym: OATPB, OATP-B, OATP2B1, SLC21A9

Produktbeschreibung

Rabbit polyclonal antibody to SLCO2B1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 77kDa
• NCBI: 009187
• UniProt: O94956
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
• Target-Kategorie: SLCO2B1

Bilder

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

Rabbit Anti-SLCO2B1 Antibody, Catalog Number: orb578985, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.