Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
Target:
SLCO2B1
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.
Rabbit Anti-SLCO2B1 Antibody, Catalog Number: orb578985, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
* VAT and and shipping costs not included. Errors and price changes excepted