CBS Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: CBS Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB579564
• Hersteller Artikelnummer: orb579564
• Alternativnummer: BYT-ORB579564-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBS
• Konjugation: Unconjugated
• Alternative Synonym: CBSL, HIP4

Produktbeschreibung

Rabbit polyclonal antibody to CBS

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 61 kDa
• NCBI: 000062
• UniProt: P35520
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
• Target-Kategorie: CBS

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Human kidney

Kidney

Mouse Brain

WB Suggested Anti-CBS Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.