CBS Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CBS Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB579564
• Supplier Catalog Number: orb579564
• Alternative Catalog Number: BYT-ORB579564-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBS
• Conjugation: Unconjugated
• Alternative Names: CBSL, HIP4

Product Description

Rabbit polyclonal antibody to CBS

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 61 kDa
• NCBI: 000062
• UniProt: P35520
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
• Target: CBS

Images

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Human kidney

Kidney

Mouse Brain

WB Suggested Anti-CBS Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.