FZR1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: FZR1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB581330
• Hersteller Artikelnummer: orb581330
• Alternativnummer: BYT-ORB581330-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
• Konjugation: Unconjugated
• Alternative Synonym: FZR, CDH1, FZR2, HCDH, HCDH1, CDC20C

Produktbeschreibung

Rabbit polyclonal antibody to FZR1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 55kDa
• NCBI: 057347
• UniProt: Q9UM11
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
• Target-Kategorie: FZR1

Bilder

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FZR1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.