FZR1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: FZR1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB581330
• Supplier Catalog Number: orb581330
• Alternative Catalog Number: BYT-ORB581330-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FZR1
• Conjugation: Unconjugated
• Alternative Names: FZR, CDH1, FZR2, HCDH, HCDH1, CDC20C

Product Description

Rabbit polyclonal antibody to FZR1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 55kDa
• NCBI: 057347
• UniProt: Q9UM11
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
• Target: FZR1

Images

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. FZR1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.