DBT Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DBT Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB581529
• Hersteller Artikelnummer: orb581529
• Alternativnummer: BYT-ORB581529-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DBT
• Konjugation: Unconjugated
• Alternative Synonym: E2, E2B, BCATE2, BCKADE2, BCKAD-E2, BCKDH-E2, BCOADC-E2

Produktbeschreibung

Rabbit polyclonal antibody to DBT

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 46kDa
• NCBI: 001909
• UniProt: P11182
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
• Target-Kategorie: DBT

Bilder

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 0.5 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. There is BioGPS gene expression data showing that DBT is expressed in HT1080.