DBT Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: DBT Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB581529
• Supplier Catalog Number: orb581529
• Alternative Catalog Number: BYT-ORB581529-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DBT
• Conjugation: Unconjugated
• Alternative Names: E2, E2B, BCATE2, BCKADE2, BCKAD-E2, BCKDH-E2, BCOADC-E2

Product Description

Rabbit polyclonal antibody to DBT

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 46kDa
• NCBI: 001909
• UniProt: P11182
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
• Target: DBT

Images

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 0.5 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. There is BioGPS gene expression data showing that DBT is expressed in HT1080.