PIM1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB583139
| Artikelname: |
PIM1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB583139 |
| Hersteller Artikelnummer: |
orb583139 |
| Alternativnummer: |
BYT-ORB583139-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PIM |
| Rabbit polyclonal antibody to PIM1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
36kDa |
| NCBI: |
002639 |
| UniProt: |
P11309 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
| Target-Kategorie: |
PIM1 |
|
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml. |
|
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml. |
|
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml. |
|
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml. |
|
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml. |
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
Positive control (+): Mouse testis (M-TE), Negative control (-): Mouse brain (M-BR), Antibody concentration: 1 ug/ml. |
|
WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart. |